Proteintech, 33132-1-AP, Phosducin Polyclonal antibody

Size: 20ul / 150ul The Phosducin (33132-1-AP) by Proteintech is a Polyclonal antibody targeting Phosducin in WB, IHC, ELISA applications with reactivity to human, mouse samples 33132-1-AP targets Phosducin in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse retina tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Phosducin/PDC, which tightly binds betagamma-subunits of heterotrimeric G-proteins, has been conjectured to play a role in regulating second messenger signaling cascades. Phosducin may act as a phosphorylation-dependent switch in second messenger signaling cascades, regulating the kinetics of desensitization processes by controlling the activity of Gbetagamma-dependent GRKs (PMID: 9020189). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37137 Product name: Recombinant human PDC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-140 aa of NM_002597.4 Sequence: KFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGKQFLETIEKELKITTIVVHI Predict reactive species Full Name: phosducin Calculated Molecular Weight: 28 kDa, 246 aa Observed Molecular Weight: 32 kDa GenBank Accession Number: NM_002597.4 Gene Symbol: PDC Gene ID (NCBI): 5132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P20941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.