Iright
BRAND / VENDOR: Proteintech

Proteintech, 33139-1-AP, KIF18B Polyclonal antibody

CATALOG NUMBER: 33139-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KIF18B (33139-1-AP) by Proteintech is a Polyclonal antibody targeting KIF18B in IF/ICC, IP, ELISA applications with reactivity to human samples 33139-1-AP targets KIF18B in IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Jurkat cells Positive IF/ICC detected in: U2OS cells, Jurkat cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information KIF18B is a key member of the kinesin-8 family, involved in regulating various physiological processes such as microtubule length, spindle assembly, and chromosome alignment. This article briefly introduces the structure and physiological functions of KIF18B, examines its role in malignant tumors, and the associated carcinogenic signaling pathways such as PI3K/AKT, Wnt/β-catenin, and mTOR pathways. Research indicates that the upregulation of KIF18B enhances tumor malignancy and resistance to radiotherapy and chemotherapy. KIF18B could become a new target for anticancer drugs, offering significant potential for the treatment of malignant tumors and reducing chemotherapy resistance (PMID: 39259333). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36663 Product name: Recombinant human KIF18B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC136590 Sequence: MAVEDSTLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDGPKKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGA Predict reactive species Full Name: kinesin family member 18B Calculated Molecular Weight: 852 aa, 93 kDa/833 aa, 91 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC136590 Gene Symbol: KIF18B Gene ID (NCBI): 146909 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86Y91 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924