Proteintech, 33144-1-AP, ANXA8 Polyclonal antibody

Size: 20ul / 150ul The ANXA8 (33144-1-AP) by Proteintech is a Polyclonal antibody targeting ANXA8 in WB, ELISA applications with reactivity to human, mouse, rat samples 33144-1-AP targets ANXA8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Calu-1 cells, HeLa cells, mouse skin tissue, rat skin tissue Recommended dilution Western Blot (WB): WB : 1:3000-1:8000 Background Information Annexin A8 (ANXA8) gene, a member of the annexin family, encodes an anticoagulant protein involved in blood coagulation cascade and acts as an indirect inhibitor of the thromboplastin-specific complex. ANXA8 promotes the proliferation of endometrial cells through the Akt signalling pathway (PMID: 30040162). The expression levels of multiple cellular factors, including EGFR, PI3K, Akt, mTOR, p70S6K and 4EBP1, in the epidermal growth factor receptor (EGFR) signaling pathway were also altered by ANXA8 knockdown or overexpression in A549 cells, which confirmed the activation of the EGFR/Akt/mTOR signaling pathway by ANXA8 (PMID: 34671007). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39741 Product name: Recombinant human ANXA8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-188 aa of BC073755 Sequence: DLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPALALQDAQDLYA Predict reactive species Full Name: annexin A8 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC073755 Gene Symbol: ANXA8 Gene ID (NCBI): 653145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P13928 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.