Proteintech, 33146-1-AP, L3HYPDH Polyclonal antibody

Size: 20ul / 150ul The L3HYPDH (33146-1-AP) by Proteintech is a Polyclonal antibody targeting L3HYPDH in WB, ELISA applications with reactivity to human, mouse, rat samples 33146-1-AP targets L3HYPDH in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, PC-3 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Trans-3-hydroxy-L-proline dehydratase (L3HYPDH) is an enzyme that catalyzes the conversion of trans-3-hydroxy-L-proline to delta(1)-pyrroline-2-carboxylate. This enzyme is involved in the degradation of dietary proteins containing trans-3-hydroxy-L-proline, such as collagen IV. Additionally, L3HYPDH has been identified as an interferon-stimulated gene (ISG) with antiviral activity, particularly against viruses like EV71 (PMID: 35891782). It also plays a role in the genetic regulation of working memory and has been implicated in the mitochondrial pathway associated with autism spectrum disorder (PMID: 32490597). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37121 Product name: Recombinant human C14orf149 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 195-354 aa of BC012131 Sequence: VTAEKLGLDICSAKTRDLVDAASAVTEAVKAQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDGFLLK Predict reactive species Full Name: chromosome 14 open reading frame 149 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC012131 Gene Symbol: C14orf149 Gene ID (NCBI): 112849 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96EM0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.