Proteintech, 33184-1-AP, FCRL1 Polyclonal antibody

Size: 20ul / 150ul The FCRL1 (33184-1-AP) by Proteintech is a Polyclonal antibody targeting FCRL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 33184-1-AP targets FCRL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Fc receptor-like protein 1 (FCRL1) is a type I transmembrane glycoprotein that plays a crucial role in regulating B-cell receptor (BCR)-mediated signaling responses (PMID:15479727). It contains intracellular tyrosine-based motifs that can modulate BCR signaling, leading to changes in calcium flux, proliferation, and antibody production (PMID: 37822931). FCRL1 is involved in regulating B-cell development and activation, with its signaling pathways influencing ERK activation through interactions with proteins such as GRB2. This regulation is essential for maintaining B-cell homeostasis and preventing the development of autoreactive B cells (PMID: 34697226). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3713 Product name: Recombinant Human FCRL1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 17-307 aa of BC033690 Sequence: AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNHLTS Predict reactive species Full Name: Fc receptor-like 1 Calculated Molecular Weight: 429 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC033690 Gene Symbol: FCRL1 Gene ID (NCBI): 115350 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96LA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.