Iright
BRAND / VENDOR: Proteintech

Proteintech, 33194-1-AP, KCTD19 Polyclonal antibody

CATALOG NUMBER: 33194-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KCTD19 (33194-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD19 in WB, ELISA applications with reactivity to human, mouse, rat samples 33194-1-AP targets KCTD19 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36660 Product name: Recombinant human KCTD19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_001100915.3 Sequence: MEESGMAHESAEDLFHFNVGGWHFSVPRSKLSQFPDSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNLLYEQALGLQLMPLLQTLDNLKEGKHHLRVRPADLPVAERASLNYWRTWKCISKPSEFPIKSPAFT Predict reactive species Full Name: potassium channel tetramerisation domain containing 19 Calculated Molecular Weight: 105 kDa,926aa Observed Molecular Weight: 105 kDa GenBank Accession Number: NM_001100915.3 Gene Symbol: KCTD19 Gene ID (NCBI): 146212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q17RG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924