Proteintech, 33212-1-AP, TMEM16A/DOG1 Polyclonal antibody

Size: 20ul / 150ul The TMEM16A/DOG1 (33212-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM16A/DOG1 in IHC, IF-P, ELISA applications with reactivity to human samples 33212-1-AP targets TMEM16A/DOG1 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ANO1 also named as DOG1, ORAOV2, TAOS2 and TMEM16A, acts as a calcium-activated chloride channel. It is required for normal tracheal development. ANO1 (or DOG1) is used as an aid in the identification and diagnosis of gastrointestinal stromal tumors (GIST) within the context of an antibody panel, the patient's clinical history, and other diagnostic tests evaluated by a qualified pathologist. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37099 Product name: Recombinant human ANO1,DOG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 428-519 aa of NM_018043.5 Sequence: KRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTN Predict reactive species Full Name: anoctamin 1, calcium activated chloride channel Calculated Molecular Weight: 114kDa，986aa GenBank Accession Number: NM_018043.5 Gene Symbol: TMEM16A Gene ID (NCBI): 55107 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5XXA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.