Proteintech, 33216-1-AP, ZNF551 Polyclonal antibody

Size: 20ul / 150ul The ZNF551 (33216-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF551 in WB, IHC, ELISA applications with reactivity to human, mouse samples 33216-1-AP targets ZNF551 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: DU 145 cells, HEK-293 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35151 Product name: Recombinant human ZNF551 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-293 aa of BC005868 Sequence: QVRTSKGNTPTQKTHLSEIKMCVPVLKDILPAAEHQTTSPVQKSYLGSTSMRGFCFSADLHQHQKHYNEEEPWKRKVDEATFVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFNAKSYYKWGEYRKASSHKHTLVQHQSVCSEGGLYECSKCEKAFTCKNTLVQHQQIHTGQKMFECSECEESFSKKCHLILHKIIHTGERPYEC Predict reactive species Full Name: zinc finger protein 551 Calculated Molecular Weight: 670 aa, 78 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC005868 Gene Symbol: ZNF551 Gene ID (NCBI): 90233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z340 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.