Iright
BRAND / VENDOR: Proteintech

Proteintech, 33247-1-AP, S100A9 Polyclonal antibody

CATALOG NUMBER: 33247-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The S100A9 (33247-1-AP) by Proteintech is a Polyclonal antibody targeting S100A9 in WB, IHC, IF-P, IP, ELISA applications with reactivity to mouse samples 33247-1-AP targets S100A9 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse spleen tissue Positive IP detected in: mouse spleen tissue, mouse ovary tissue Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2600 Product name: Recombinant Mouse S100a9 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-113 aa of NM_001281852.1 Sequence: ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK Predict reactive species Full Name: S100 calcium binding protein A9 (calgranulin B) Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: NM_001281852.1 Gene Symbol: S100a9 Gene ID (NCBI): 20202 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P31725 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924