Iright
BRAND / VENDOR: Proteintech

Proteintech, 33265-1-AP, FBXL6 Polyclonal antibody

CATALOG NUMBER: 33265-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXL6 (33265-1-AP) by Proteintech is a Polyclonal antibody targeting FBXL6 in WB, ELISA applications with reactivity to human samples 33265-1-AP targets FBXL6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 786-O cells, ACHN cells, HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information FBXL6 is an F-box/LRR-type E3 ubiquitin ligase that serves as the substrate-recognition subunit of the SCF complex. It stabilizes HSP90AA1 via K63-linked ubiquitination to activate c-MYC and drive hepatocellular carcinoma progression, while also degrading defective mitochondrial ribosomal proteins to preserve mitochondrial proteostasis. Its overexpression correlates with poor prognosis in renal and colorectal cancers and can promote cell proliferation by down-regulating RPL11 to activate the MDM2-p53 axis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36604 Product name: Recombinant human FBXL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of NM_012162.3 Sequence: MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKKLL Predict reactive species Full Name: F-box and leucine-rich repeat protein 6 Calculated Molecular Weight: 59kDa,539aa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_012162.3 Gene Symbol: FBXL6 Gene ID (NCBI): 26233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N531 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924