Proteintech, 33278-1-AP, hCG Beta Polyclonal antibody

Size: 20ul / 150ul The hCG Beta (33278-1-AP) by Proteintech is a Polyclonal antibody targeting hCG Beta in WB, IHC, ELISA applications with reactivity to human samples 33278-1-AP targets hCG Beta in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: JAR cells, Forskolin treated JAR cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Beta-hCG (beta-human chorionic gonadotropin) is a glycoprotein hormone produced by the placenta during pregnancy. It is a critical marker used in both obstetrics and oncology for various diagnostic and monitoring purposes. hCG is composed of two subunits: an alpha subunit (similar to other glycoprotein hormones like LH, FSH, and TSH) and a unique beta subunit (β-hCG). The beta subunit is the primary focus for diagnostic tests due to its specificity. β-hCG is initially secreted by the syncytiotrophoblast cells surrounding the developing embryo and later by the placenta. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38044 Product name: Recombinant human CGB5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-165 aa of BC051378 Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ Predict reactive species Full Name: chorionic gonadotropin, beta polypeptide 5 Calculated Molecular Weight: 165 aa, 18 kDa Observed Molecular Weight: 19, 21 kDa GenBank Accession Number: BC051378 Gene Symbol: CGB5 Gene ID (NCBI): 93659 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0DN86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.