Proteintech, 33279-1-AP, XPC Polyclonal antibody

Size: 20ul / 150ul The XPC (33279-1-AP) by Proteintech is a Polyclonal antibody targeting XPC in WB, ELISA applications with reactivity to human samples 33279-1-AP targets XPC in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information XPC (DNA repair protein complementing XP-C cells) protein is a pivotal DNA damage recognition factor that plays an indispensable role in the global-genome nucleotide excision repair (GG-NER) pathway. As the primary initiator of GG-NER, it acts as a universal sensor for a wide array of helix-distorting DNA lesions, including those induced by ultraviolet (UV) radiation and chemical carcinogens. Upon binding to damaged DNA, the XPC complex orchestrates the recruitment of the entire repair machinery, serving as a critical guardian of genomic integrity. The calculated molecular weight of XPC is about 106 kDa, but due to post-translational modifications, about 120 kDa will be observed. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38513 Product name: Recombinant human XPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 685-867 aa of NM_004628.4 Sequence: HSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGP Predict reactive species Full Name: xeroderma pigmentosum, complementation group C Calculated Molecular Weight: 106kDa，940aa Observed Molecular Weight: 106-120 kDa GenBank Accession Number: NM_004628.4 Gene Symbol: XPC Gene ID (NCBI): 7508 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q01831 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.