Proteintech, 33326-1-AP, Tesmin Polyclonal antibody

Size: 20ul / 150ul The Tesmin (33326-1-AP) by Proteintech is a Polyclonal antibody targeting Tesmin in WB, ELISA applications with reactivity to human samples 33326-1-AP targets Tesmin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Testis Expressed Metallothionein Like Protein (Tesmin), also known as Metallothionein-Like 5 (MTL5), encodes the metallothionein-like protein owning some characteristics of metallothionein. Tesmin is a 60 kDa protein which has cysteine-rich motifs (CXC domain), characteristic of metallothioneins (MTs). Tesmin was closely related to meiosis in the reproductive process. As a testis-specific protein, the localization of Tesmin changed dynamically with the progression of meiosis in a mouse experiment, the process of which might be responsive to metal stress like cadmium by oxidative stress (Cd), as well as require the involvement of LIN9. So far, the expression of Tesmin in adult humans has been observed in prostate and gastric cancer (PMID: 39229988, PMID: 33281959, PMID: 31059101). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39255 Product name: Recombinant human MTL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-306 aa of NM_004923.3 Sequence: VEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAG Predict reactive species Full Name: metallothionein-like 5, testis-specific (tesmin) Calculated Molecular Weight: 55kDa，508aa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_004923.3 Gene Symbol: MTL5 Gene ID (NCBI): 9633 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y4I5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.