Proteintech, 33333-1-AP, SKA2 Polyclonal antibody

Size: 20ul / 150ul The SKA2 (33333-1-AP) by Proteintech is a Polyclonal antibody targeting SKA2 in WB, ELISA applications with reactivity to human samples 33333-1-AP targets SKA2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SKA2 (spindle and KT associated 2), also referred to as FAM33A (family with sequence similarity 33, member A), is a recently identified gene involved in cell cycle regulation, and growing evidence is implicating its roles in tumorigenesis and psychiatric disorders. It has been demonstrated that SKA2, along with its coworkers SKA1 and SKA3, constitutes the SKA complex which plays a critical role in the maintenance of the metaphase plate and/or spindle checkpoint silencing during mitosis. SKA2 is over-expressed both in cancer cell lines and clinical samples including small cell lung cancer and breast cancer, whereas downregulation of SKA2 is associated with depression and suicidal ideation. The expression of SKA2 is regulated by transcription factors including NF-κΒ and CREB, miRNAs as well as DNA methylation (PMID: 30906829). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37037 Product name: Recombinant human FAM33A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC017873 Sequence: MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL Predict reactive species Full Name: family with sequence similarity 33, member A Calculated Molecular Weight: 121 aa, 14 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC017873 Gene Symbol: FAM33A Gene ID (NCBI): 348235 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WVK7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.