Proteintech, 33334-1-AP, ARMS2 Polyclonal antibody

Size: 20ul / 150ul The ARMS2 (33334-1-AP) by Proteintech is a Polyclonal antibody targeting ARMS2 in IHC, ELISA applications with reactivity to human, mouse samples 33334-1-AP targets ARMS2 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Age-related maculopathy susceptibility 2 (ARMS2) is a small (11 kDa), primate-specific protein found in the extracellular matrix of the choroid layer in the eye. Variants in the corresponding genetic locus are highly associated with age-related macular degeneration, a leading cause of blindness in the elderly (PMID: 27270414). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37837 Product name: Recombinant human ARMS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of NM_001099667 Sequence: MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR Predict reactive species Full Name: age-related maculopathy susceptibility 2 Calculated Molecular Weight: 107aa, 11 kDa GenBank Accession Number: NM_001099667 Gene Symbol: ARMS2 Gene ID (NCBI): 387715 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0C7Q2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.