Proteintech, 33364-1-AP, ATP6V0D2 Polyclonal antibody

Size: 20ul / 150ul The ATP6V0D2 (33364-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V0D2 in WB, ELISA applications with reactivity to human, mouse, rat samples 33364-1-AP targets ATP6V0D2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ATP6V0D2 is a subunit of the vacuolar proton-translocating ATPase (V-ATPase) complex, which is responsible for acidifying intracellular compartments and the extracellular environment. This protein is crucial for maintaining the acidic environment necessary for various cellular processes, including bone resorption by osteoclasts (PMID: 19113919). ATP6V0D2 is also involved in the regulation of tumor-associated macrophages, where it influences tumor progression through the lactate/ATP6V0D2/HIF-2α axis (PMID: 30431439). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38739 Product name: Recombinant human ATP6V0D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-349 aa of BC065207 Sequence: ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI Predict reactive species Full Name: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC065207 Gene Symbol: ATP6V0D2 Gene ID (NCBI): 245972 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N8Y2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.