Iright
BRAND / VENDOR: Proteintech

Proteintech, 33375-1-AP, CELA2A Polyclonal antibody

CATALOG NUMBER: 33375-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CELA2A (33375-1-AP) by Proteintech is a Polyclonal antibody targeting CELA2A in WB, ELISA applications with reactivity to mouse, rat samples 33375-1-AP targets CELA2A in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information CELA2A (Chymotrypsin-like elastase family member 2A), also known as Elastase-2A, is a circulating enzyme that reduces platelet hyperactivation, triggers both insulin secretion and degradation, and increases insulin sensitivity. ELA-2 is widely found in several organs such as lung, pancreas, liver, blood vessels (mesenteric, and carotid arteries), heart and kidney of rodents (PMID: 31358993, 28386233). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3064 Product name: recombinant mouse CELA2A protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 17-271 aa of NM_007919.3 Sequence: CGYPTYEVEDDVSRVVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN Predict reactive species Full Name: elastase 2A Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: NM_007919.3 Gene Symbol: RP23-395H4.4 Gene ID (NCBI): 13706 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P05208 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924