Iright
BRAND / VENDOR: Proteintech

Proteintech, 33399-1-AP, CD169 Polyclonal antibody

CATALOG NUMBER: 33399-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD169 (33399-1-AP) by Proteintech is a Polyclonal antibody targeting CD169 in WB, IHC, ELISA applications with reactivity to mouse, rat samples 33399-1-AP targets CD169 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue Positive IHC detected in: mouse spleen tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CD169, also known as sheep erythrocyte receptor (SER), Sialoadhesin (Sn) or Siglec-1, is a sialic acid-binding immunoglobulin-like lectin that belongs to the SIGLEC family of the Ig superfamily (PMID: 3783087; 11133773). CD169 is a single-pass transmembrane protein containing a long extracellular domain, a transmembrane region, and a short cytoplasmic tail (PMID: 11133773). It is primarily expressed on the surface of specific macrophage subsets and its precursor monocytes, as well as on some DCs (PMID: 33408860). CD169 binds to sialic acid-containing glycoconjugates, particularly those with α(2,3)-linkages. It is involved in immune regulation, pathogen recognition, and cell-cell interactions. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg5002 Product name: recombinant mouse Siglec1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-510 aa of NP_035556 Sequence: TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTDPSPPTITIPEELREGMERNFNCSTPYLCLQEKQVSLQWRGQDPTHSVTSSFQSLEPTGVYHQTTLHMALSWQDHGRTLLCQFSLGAHSSRKEVYLQVPHAPKGVEILLSSSGRNILPGDPVTLTCRVNSSYPAVSAVQWARDGVNLGVTGHVLRLFSAAWNDSGAYTCQATNDMGSLVSSPLSLHVFMAEVKMNPAGPVLENETVTLLCSTPKEAPQELRYSWYKNHILLEDAHASTLHLPAVTRADTGFYFCEVQNAQGSERSSPLSVVVRYPPLTPDLTTFLETQAGLVGILHCSVVSEPLATVVLSHGGLTLASNSGENDFNPRFRISSAPNSLRLEIRDLQPADSGEYTCLAVNSLGNSTSSLDFYAN Predict reactive species Full Name: sialic acid binding Ig-like lectin 1, sialoadhesin Calculated Molecular Weight: 183 kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: NP_035556 Gene Symbol: Siglec1 Gene ID (NCBI): 20612 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q62230-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924