Proteintech, 33446-1-AP, CIMIP2C Polyclonal antibody

Size: 20ul / 150ul The CIMIP2C (33446-1-AP) by Proteintech is a Polyclonal antibody targeting CIMIP2C in WB, ELISA applications with reactivity to human, mouse samples 33446-1-AP targets CIMIP2C in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse spermatophore tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CIMIP2C (ciliary microtubule inner protein 2C), also known as C2orf70, FAM166C, encodes a microtubule inner protein (MIP) that is an integral component of the dynein-decorated doublet microtubules (DMTs) within the axoneme of motile cilia. CIMIP2C shows biased expression in the testis, consistent with its role in flagellated sperm motility (PMID: 37989994). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37807 Product name: Recombinant human CIMIP2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of NM_001105519 Sequence: MASRSAGTLLTEFNAAYVPPGLMPGYQGHVPTVAFSFGAPYGTTTLKYFQDHRNRAMEKSHTPFSQGGHFPTIFSTNPNLLLMERASTRDRWLHKPSYTRFNLDSHRSTELTNFYQMVQQHRKYYQDKTGTVPRVPYFAMPVREPERYPLPTVLPPLCPKKKWHLLRLAPENLKTYQTFPSGKRVSPQERKKRDCYFEFRA Predict reactive species Full Name: chromosome 2 open reading frame 70 Calculated Molecular Weight: 201aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: NM_001105519 Gene Symbol: C2orf70 Gene ID (NCBI): 339778 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NJV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.