Proteintech, 33500-1-AP, WDR42A Polyclonal antibody

Size: 20ul / 150ul The WDR42A (33500-1-AP) by Proteintech is a Polyclonal antibody targeting WDR42A in WB, ELISA applications with reactivity to human samples 33500-1-AP targets WDR42A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information WD repeat-containing protein 42A (WDR42A), also named DDB1- and CUL4- associated factor 8 (DCAF8), is a member of the WD40-repeat proteins (PMID: 22500989). WDR42A is a nucleocytoplasmic shuttling protein. WDR42A acts as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex, which is involved in protein ubiquitination (Uniprot). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38765 Product name: Recombinant human WDR42A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC099709 Sequence: MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRSE Predict reactive species Full Name: WD repeat domain 42A Calculated Molecular Weight: 597 aa, 67 kDa Observed Molecular Weight: 67-73 kDa GenBank Accession Number: BC099709 Gene Symbol: WDR42A Gene ID (NCBI): 50717 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5TAQ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.