Proteintech, 33503-1-AP, MICALL1 Polyclonal antibody

Size: 20ul / 150ul The MICALL1 (33503-1-AP) by Proteintech is a Polyclonal antibody targeting MICALL1 in WB, ELISA applications with reactivity to human samples 33503-1-AP targets MICALL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HepG2 cells, L02 cells, MG-63 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information MICALL1 (MICAL-like protein 1) is a protein involved in the regulation of cytoskeleton dynamics and is a member of the MICAL family. This protein interacts with other molecules through its N-terminal CH domain and C-terminal coiled-coil domain, primarily regulating the stability of microtubules and actin, thereby affecting processes such as cell shape, migration, and intracellular transport. Studies have shown that MICALL1 plays a key role in neuronal axon guidance, angiogenesis, and the establishment of epithelial cell polarity. Additionally, it binds to Rab GTPases (such as Rab8a) and is involved in vesicle transport and membrane remodeling. Aberrant expression of MICALL1 is associated with tumor metastasis and neurological diseases, with its molecular mechanisms involving precise regulation of cytoskeleton rearrangement, making it a potential therapeutic target. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39169 Product name: Recombinant human MICALL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 750-863 aa of NM_033386.3 Sequence: NLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS Predict reactive species Full Name: MICAL-like 1 Calculated Molecular Weight: 93kDa，863aa Observed Molecular Weight: 125 kDa GenBank Accession Number: NM_033386.3 Gene Symbol: MICALL1 Gene ID (NCBI): 85377 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N3F8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.