Iright
BRAND / VENDOR: Proteintech

Proteintech, 33530-1-AP, ORM3 Polyclonal antibody

CATALOG NUMBER: 33530-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ORM3 (33530-1-AP) by Proteintech is a Polyclonal antibody targeting ORM3 in WB, ELISA applications with reactivity to mouse samples 33530-1-AP targets ORM3 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, PNGF treated mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg7180 Product name: Recombinant mouse Orm3 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-208 aa of / Sequence: QNPEHAINIGDPITNETLSWLSGKWFFIAAADSDPDYRQEIQKVQTIFFYLTLNLINDTMELREYHTKDDHCVYNSNLLGFQRENGTLFKYGEEGEVETLLHLRVLEKHGAIMLFFDLKDEKKRGLSLSARRPDIPPELREVFQKAVTHVGMDESEIIFVDWKKDRCSEQEKKHLELEKETKKDPEESQA Predict reactive species Full Name: orosomucoid 3 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa, 40 kDa GenBank Accession Number: / Gene Symbol: Orm3 Gene ID (NCBI): 18407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: B7ZP06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924