Iright
BRAND / VENDOR: Proteintech

Proteintech, 33531-1-AP, FCGR4/CD16-2 Polyclonal antibody

CATALOG NUMBER: 33531-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FCGR4/CD16-2 (33531-1-AP) by Proteintech is a Polyclonal antibody targeting FCGR4/CD16-2 in WB, ELISA applications with reactivity to mouse samples 33531-1-AP targets FCGR4/CD16-2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Fc gamma receptors (FcγRs) are receptors for the Fc region of immunoglobulin G (IgG) antibodies and play important roles in immune responses. Mouse FCGR4, also known as CD16-2 or FcgammaRIV, is the mouse ortholog of primate FcgammaRIII (PMID: 12389094; 16039578; 17558411). FCGR4 is expressed on monocytes, macrophages, and neutrophils, and it binds to IgG2a and IgG2b with intermediate affinity (PMID: 16039578). It also acts as a receptor for the Fc region of immunoglobulin epsilon (IgE) (PMID: 17558411; 18949059). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg7179 Product name: Recombinant mouse FcgR4/CD16-2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-203 aa of NM_144559.2 Sequence: GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ Predict reactive species Full Name: Fc receptor, IgG, low affinity IV Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: NM_144559.2 Gene Symbol: Fcgr4 Gene ID (NCBI): 246256 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A0A0B4J1G0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924