Proteintech, 33551-1-AP, Galectin-7 Polyclonal antibody

Size: 20ul / 150ul The Galectin-7 (33551-1-AP) by Proteintech is a Polyclonal antibody targeting Galectin-7 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 33551-1-AP targets Galectin-7 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse skin tissue, rat skin tissue, pig skin tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-7 contains one carbohydrate recognition domain (CRD) and is biologically active as monomer. It is mainly expressed in stratified epithelium, especially in epidermis. Alterations of galectin-7 expression during cancer progression have been reported. Galectin-7 is involved in epithelial differentiation and development and may have a role in tumour development (PMID: 16429325). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35876 Product name: Recombinant human LGALS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of NM_002307 Sequence: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF Predict reactive species Full Name: lectin, galactoside-binding, soluble, 7 Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: NM_002307 Gene Symbol: LGALS7 Gene ID (NCBI): 3963 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P47929 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.