Iright
BRAND / VENDOR: Proteintech

Proteintech, 33559-1-AP, SLC9A3/NHE3 Polyclonal antibody

CATALOG NUMBER: 33559-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC9A3/NHE3 (33559-1-AP) by Proteintech is a Polyclonal antibody targeting SLC9A3/NHE3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 33559-1-AP targets SLC9A3/NHE3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: 37°C incubated mouse kidney tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse small intestine tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SLC9A3, also known as NHE3, belongs to the sodium hydrogen exchange protein family (NHE) and is mainly responsible for regulating the concentration of sodium and hydrogen ions inside and outside the cell. SLC9A3 is a Major apical Na+/H+ exchanger in kidney and intestine, playing an important role in renal and intestine Na+ absorption and blood pressure regulation (PMID:24622516, 2635877). Mutations in SLC9A3 cause Congenital Sodium Diarrhea (PMID: 26358773, 31276831). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38302 Product name: Recombinant human SLC9A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 750-834 aa of BC101669 Sequence: AGIDNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFRRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM Predict reactive species Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 3 Calculated Molecular Weight: 834 aa, 93 kDa Observed Molecular Weight: 80-100 kDa GenBank Accession Number: BC101669 Gene Symbol: NHE3 Gene ID (NCBI): 6550 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P48764 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924