Iright
BRAND / VENDOR: Proteintech

Proteintech, 33595-1-AP, NCAPH2 Polyclonal antibody

CATALOG NUMBER: 33595-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NCAPH2 (33595-1-AP) by Proteintech is a Polyclonal antibody targeting NCAPH2 in WB, ELISA applications with reactivity to human, mouse samples 33595-1-AP targets NCAPH2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, PC-12 cells, J774A.1 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NCAPH2 is a subunit of the condensin-2 complex involved in chromosome condensation during mitosis and meiosis. Peripheral blood DNA methylation levels in the NCAPH2/LMF2 promoter region were significantly decreased in patients with AD and those with amnestic mild cognitive impairment (aMCI); therefore, these are considered to be a potentially useful biomarker for the diagnosis of AD. (PMID: 33603659) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38706 Product name: Recombinant mouse Ncaph2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 450-607 aa of NM_001115132 Sequence: VMPEEAADLDAEAMPESLRYEELVRRNVELFIATSQKFIQETELSQRIRDWEDTIQPLLQEQEQHVPFDIHIYGDQLASRFPQLNEWCPFSELVAGQPAFEVCRSMLASLQLANDYTVEITQQPGLEAAVDTMSLRLLTHQRAHTRFQTYAAPSMAQP* Predict reactive species Full Name: non-SMC condensin II complex, subunit H2 Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 68-80 kDa GenBank Accession Number: NM_001115132 Gene Symbol: Ncaph2 Gene ID (NCBI): 52683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8BSP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924