Proteintech, 33605-1-AP, ZZEF1 Polyclonal antibody

Size: 20ul / 150ul The ZZEF1 (33605-1-AP) by Proteintech is a Polyclonal antibody targeting ZZEF1 in WB, ELISA applications with reactivity to human, mouse samples 33605-1-AP targets ZZEF1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, mouse heart tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ZZEF1 is a large cytoplasmic protein distinguished by a ZZ-type zinc finger and an EF-hand calcium-binding domain, hinting at a role in linking protein-protein interactions with calcium-mediated signaling. Its functions are not fully elucidated, but growing evidence suggests involvement in cilia formation, cytoskeletal organization, and cell signaling regulation. Mutations or dysregulation of ZZEF1 have been linked to ciliopathies, tumor biology, and possible neurodevelopmental conditions, making it a gene of emerging biomedical interest. (PMID: 33227311) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35406 Product name: Recombinant human ZZEF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2480-2600 aa of BC151836 Sequence: ILRAIYELQMKKTDYFFLEVQKRFDGDELTTDERIRSLAQRWQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLISSTESELQQSYAKQRRSKSAALLHKELNCKSK Predict reactive species Full Name: zinc finger, ZZ-type with EF-hand domain 1 Observed Molecular Weight: 300-330 kDa GenBank Accession Number: BC151836 Gene Symbol: ZZEF1 Gene ID (NCBI): 23140 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O43149 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.