Proteintech, 33633-1-AP, TRABD Polyclonal antibody

Size: 20ul / 150ul The TRABD (33633-1-AP) by Proteintech is a Polyclonal antibody targeting TRABD in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 33633-1-AP targets TRABD in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human testis tissue, mouse brain tissue, rat brain tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TraB domain-containing protein (TRABD) is also named TTG2. TRABD is a Tiki/TraB family protein that is highly expressed in the brains of patients with AD (PMID: 33446646). TRABD as a novel outer mitochondrial membrane protein. Depletion of TRABD in cells severely impairs mitochondrial respiration and ATP production, inhibits cell growth, increases reactive oxygen species levels (PMID: 40778267). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40480 Product name: Recombinant human TRABD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC093029 Sequence: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMKLKRRRQRPNLPRTVTQLVAEDGSRVYVVGTAHFSD Predict reactive species Full Name: TraB domain containing Observed Molecular Weight: 37 kDa GenBank Accession Number: BC093029 Gene Symbol: TRABD Gene ID (NCBI): 80305 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H4I3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.