Proteintech, 33666-1-AP, CD228/MFI2 Polyclonal antibody

Size: 20ul / 150ul The CD228/MFI2 (33666-1-AP) by Proteintech is a Polyclonal antibody targeting CD228/MFI2 in WB, ELISA applications with reactivity to mouse samples 33666-1-AP targets CD228/MFI2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CD228, also known as Melanotransferrin (MTF), p97, MFI2, etc., is an iron-binding glycoprotein belonging to the transferrin family. In normal tissues, the expression of CD228 is low, mainly confined to skin epidermis, brain endothelium, renal tubules, sweat gland and salivary gland ducts. However, in many tumor tissues, such as melanoma, non-small cell lung cancer, colorectal cancer, pancreatic cancer and so on, the expression of CD228 increased significantly. Soluble CD228 can cross the blood-brain barrier by interacting with transferrin receptor. In the brain, CD228 is located in microglia related to amyloid plaque cells in Alzheimer's disease. The increased concentration of CD228 in serum can be regarded as a surrogate marker of Alzheimer's disease. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg6302 Product name: Recombinant mouse CD228/MFI2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-708 aa of NM_013900.2 Sequence: VMEVQWCTISDAEQQKCKDMSEAFQGAGIRPSLLCVQGNSADHCVQLIKEQKADAITLDGGAIYEAGKEHGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVTINTLKGVKSCHTGINRTVGWNVPVGYLVESGHLSVMGCDVLKAVGDYFGGSCVPGTGETSHSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGNTLPSWGKSLMSEDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRGDMDGGLIFQLLNEGQLLFSHEDSSFQMFSSKAYSQKNLLFKDSTLELVPIATQNYEAWLGQEYLQAMKGLLCDPNRLPHYLRWCVLSAPEIQKCGDMAVAFSRQNLKPEIQCVSAESPEHCMEQIQAGHTDAVTLRGEDIYRAGKVYGLVPAAGELYAEEDRSNSYFVVAVARRDSSYSFTLDELRGKRSCHPYLGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSQFFNASCVPVNNPKNYPSALCALCVGDEKGRNKCVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTVFENTNGHNPEPWASHLRWQDYELLCPNGARAEVDQFQACNLAQMPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFQMFDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQ Predict reactive species Full Name: antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 81 kDa GenBank Accession Number: NM_013900.2 Gene Symbol: Mfi2 Gene ID (NCBI): 30060 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9R0R1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.