Product Description
Size: 20ul / 150ul
The HSPA12A (33696-1-AP) by Proteintech is a Polyclonal antibody targeting HSPA12A in WB, ELISA applications with reactivity to human, mouse, rat samples
33696-1-AP targets HSPA12A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Background Information
Heat shock protein A12A (HSPA12A) is a distant member of the HSP70 family, which is widely expressed with highest levels in brain, kidney and muscle (PMID: 12552099). HSPA12A encodes a prosurvival pathway against endotoxemic liver injury. Particularly, glycolytic activity in cancer cells is regulated by HSPA12A. HSPA12A modulates glycolysis-derived lactate to affect HMGB1 lactylation and secretion from hepatocytes, by which changes macrophage chemotaxis and activation, and finally affects LI/R injury (PMID: 37441587).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag36620 Product name: Recombinant human HSPA12A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 516-675 aa of BC156889 Sequence: PPEKLLVKDGTRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRLDLTGTSGTAVPARREIQTLMQFGDTEIKATAIDIATSKSVKVGIDFLNY Predict reactive species
Full Name: heat shock 70kDa protein 12A
Calculated Molecular Weight: 675 aa, 75 kDa
Observed Molecular Weight: 75 kDa
GenBank Accession Number: BC156889
Gene Symbol: HSPA12A
Gene ID (NCBI): 259217
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: O43301
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924