Proteintech, 33697-1-AP, RAB5IF Polyclonal antibody

Size: 20ul / 150ul The RAB5IF (33697-1-AP) by Proteintech is a Polyclonal antibody targeting RAB5IF in IP, ELISA applications with reactivity to human samples 33697-1-AP targets RAB5IF in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Caco-2 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Human RAB5IF (RAB5-interacting protein) is a key effector protein of the Rab5 GTPase, primarily localized to early endosomes, where it serves as an essential functional and marker protein. By binding to activated Rab5, it participates in regulating processes such as endosome recognition, fusion, transport, and maturation, making it a core molecule in the study of clathrin-mediated endocytosis and vesicular transport. This protein plays a crucial role in maintaining endosomal dynamics and receptor sorting, while also influencing the spatiotemporal signaling of pathways such as those involving growth factor receptors. Studies suggest that functional abnormalities in RAB5IF may be associated with tumorigenesis and progression, yet its core research domains remain focused on organelle and subcellular labeling, cell biology, and intracellular signal transduction. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38730 Product name: Recombinant human C20orf24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-44 aa of BC004446 Sequence: MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDV Predict reactive species Full Name: chromosome 20 open reading frame 24 Calculated Molecular Weight: 137 aa, 15 kDa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: BC004446 Gene Symbol: C20orf24 Gene ID (NCBI): 55969 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BUV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.