Iright
BRAND / VENDOR: Proteintech

Proteintech, 33698-1-AP, TAT Polyclonal antibody

CATALOG NUMBER: 33698-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TAT (33698-1-AP) by Proteintech is a Polyclonal antibody targeting TAT in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 33698-1-AP targets TAT in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Tyrosine aminotransferase, also known as tyrosine transaminase, is the first enzyme in the catabolic pathway of tyrosine. The gene of this transaminase is regulated by glucocorticoid hormones as well as via the cAMP pathway. TAT reversibly catalyses Tyr to 4-hydroxyphenylpyruvate (4-HPP), which is the substrate for pathways producing plastoquinone31, 32, tocopherols33, phenolic acid14, 28, and benzylisoquinoline alkaloid (BIA)34 in plants, although tyrosine is synthesised from 4-HPP by TAT in bacteria (28687763). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39227 Product name: Recombinant human TAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-454 aa of BC130534 Sequence: IHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK Predict reactive species Full Name: tyrosine aminotransferase GenBank Accession Number: BC130534 Gene Symbol: TAT Gene ID (NCBI): 6898 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P17735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924