Proteintech, 33710-1-AP, IL-18 Polyclonal antibody

Size: 20ul / 150ul The IL-18 (33710-1-AP) by Proteintech is a Polyclonal antibody targeting IL-18 in WB, IP, ELISA applications with reactivity to mouse samples 33710-1-AP targets IL-18 in WB, IP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IP detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information IL18, is a proinflammatory cytokine involved in the development of Th1 cells and in immune response. It can stimulate the NK cells and certain T cells to release IFN gamma which plays an important role in activating the macrophages or other cells. IL18 has been demonstrated to have the potential to enhance Fas ligand-mediated cytotoxicity, which is increased in PE and regulates placental apoptosis. IL18 is synthesized as a 22 kDa precursor and then cleaved into a biologically activate 18 kDa form. The antibody 33710-1-AP is raised against the full length IL18 precursor, and it theoretically recognizes both the pre-IL18 and mature IL18. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg4455 Product name: recombinant mouse IL-18 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-192 aa of NM_008360.1 Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS Predict reactive species Full Name: interleukin 18 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: NM_008360.1 Gene Symbol: Il18 Gene ID (NCBI): 16173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P70380 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.