Proteintech, 33741-1-AP, ZCCHC24 Polyclonal antibody

Size: 20ul / 150ul The ZCCHC24 (33741-1-AP) by Proteintech is a Polyclonal antibody targeting ZCCHC24 in WB, ELISA applications with reactivity to human samples 33741-1-AP targets ZCCHC24 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, PC-3 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39605 Product name: Recombinant human ZCCHC24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-241 aa of NM_153367.4 Sequence: MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPTAGAAPPELAFGKGRPEQLGSPLHSSYLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ* Predict reactive species Full Name: zinc finger, CCHC domain containing 24 Calculated Molecular Weight: 27kDa，241aa Observed Molecular Weight: 27 kDa GenBank Accession Number: NM_153367.4 Gene Symbol: ZCCHC24 Gene ID (NCBI): 219654 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N2G6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.