Proteintech, 33752-1-AP, FAM82A1 Polyclonal antibody

Size: 20ul / 150ul The FAM82A1 (33752-1-AP) by Proteintech is a Polyclonal antibody targeting FAM82A1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 33752-1-AP targets FAM82A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, U2OS cells, human testis tissue, rat liver Positive IP detected in: U2OS cells Positive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FAM82A1 is a crucial cellular signaling regulatory protein that has recently gained attention for its role in tumorigenesis. Research indicates that it serves as an important regulatory subunit of protein phosphatase 2A (PP2A), participating in the precise regulation of cell cycle progression and apoptosis by influencing key signaling pathways such as JNK/c-Jun. In various cancers (e.g., glioblastoma, lung cancer), FAM82A1 often exhibits abnormally high expression, which is closely associated with accelerated cancer cell proliferation, inhibited apoptosis, and poor patient prognosis. Its cancer-promoting function is primarily achieved by sustaining cancer cell survival, making FAM82A1 not only a potential tumor biomarker but also a promising new target for anti-cancer therapy worthy of further exploration. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40522 Product name: Recombinant human FAM82A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-125 aa of BC024243 Sequence: KVRKPGIAMKLPEFLSLGNTFNSITLQDEIHDDQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKISPQHR Predict reactive species Full Name: family with sequence similarity 82, member A1 Observed Molecular Weight: 45 kDa GenBank Accession Number: BC024243 Gene Symbol: FAM82A1 Gene ID (NCBI): 151393 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96LZ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.