Proteintech, 33753-1-AP, ZRSR2 Polyclonal antibody

Size: 20ul / 150ul The ZRSR2 (33753-1-AP) by Proteintech is a Polyclonal antibody targeting ZRSR2 in WB, ELISA applications with reactivity to human samples 33753-1-AP targets ZRSR2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36984 Product name: Recombinant human ZRSR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-482 aa of BC050451 Sequence: NSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSCRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK Predict reactive species Full Name: zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2 Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC050451 Gene Symbol: ZRSR2 Gene ID (NCBI): 8233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q15696 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.