Iright
BRAND / VENDOR: Proteintech

Proteintech, 33763-1-AP, METTL10 Polyclonal antibody

CATALOG NUMBER: 33763-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The METTL10 (33763-1-AP) by Proteintech is a Polyclonal antibody targeting METTL10 in WB, IHC, ELISA applications with reactivity to human samples 33763-1-AP targets METTL10 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, DU 145 cells, Daudi cells, Raji cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:500 Background Information Methyltransferase-like 10 (METTL10) is a lysine trimethyltransferase targeting eukaryotic translation elongation factor 1A1 (eEF1A1), which is well preserved from simple eukaryotes such as Saccharomyces cerevisiae to mammals such as humans and mice. Recently, METTL10was identified as an estimated glomerular filtration rate (eGFR)-associated gene through a transethnic genome-wide association study of eGFR. (PMID: 39774961) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37000 Product name: Recombinant human METTL10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC026167 Sequence: MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFSNNVM Predict reactive species Full Name: methyltransferase like 10 Observed Molecular Weight: 26 kDa GenBank Accession Number: BC026167 Gene Symbol: METTL10 Gene ID (NCBI): 399818 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5JPI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924