Product Description
Size: 20ul / 150ul
The C10orf35 (33819-1-AP) by Proteintech is a Polyclonal antibody targeting C10orf35 in WB, ELISA applications with reactivity to human samples
33819-1-AP targets C10orf35 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MG-63 cells, U-251 cells, U2OS cells, mouse brain tissue, rat brain tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag36807 Product name: Recombinant human C10orf35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-91 aa of BC013587 Sequence: MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTS Predict reactive species
Full Name: chromosome 10 open reading frame 35
Observed Molecular Weight: 15 kDa
GenBank Accession Number: BC013587
Gene Symbol: C10orf35
Gene ID (NCBI): 219738
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q96D05
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924