Iright
BRAND / VENDOR: Proteintech

Proteintech, 33824-1-AP, MECP2 Polyclonal antibody

CATALOG NUMBER: 33824-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MECP2 (33824-1-AP) by Proteintech is a Polyclonal antibody targeting MECP2 in WB, ELISA applications with reactivity to human, mouse, rat samples 33824-1-AP targets MECP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse lung tissue, rat brain tissue, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information METHYL-CpG-BINDING PROTEIN 2(MECP2), is a chromatin-associated protein that can both activate and repress transcription. Mecp2 in the adult mouse is high in the brain, lung, and spleen, lower in heart and kidney. MECP2 takes part in the control of neuronal activity-dependent gene regulation, and this process may underlie the pathology of Rett syndrome, a severe developmental disorder with autistic phenotypes. As compared to wild-type monkeys, MECP2 transgenic monkeys exhibited a higher frequency of repetitive circular locomotion and increased stress responses, as measured by the threat-related anxiety and defensive test. Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A. Two isoforms of MECP2 exist due to alternative splicing events.This antibody reacts with the MECP2 and phosphorylated MECP2 proteins. The calculated molecular weight of MECP2 is a 52 kDa, but the post-modified MECP2 protein is about 75-80 kDa (PMID: 12160743). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29614 Product name: Recombinant human MECP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC011612 Sequence: MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPG Predict reactive species Full Name: methyl CpG binding protein 2 (Rett syndrome) Calculated Molecular Weight: 52 kDa, 53 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: BC011612 Gene Symbol: MECP2 Gene ID (NCBI): 4204 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P51608 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924