Proteintech, 33838-1-AP, ZNF157 Polyclonal antibody

Size: 20ul / 150ul The ZNF157 (33838-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF157 in WB, ELISA applications with reactivity to human samples 33838-1-AP targets ZNF157 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, PC-3 cells, SH-SY5Y cells, SK-N-SH cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ZNF157, also known as HZF22, is a zinc finger protein gene located at the X chromosome short arm region 11.3. As a member of the zinc finger protein family, ZNF157 primarily functions through its C2H2-type zinc finger domain. This domain enables ZNF157 to bind to DNA, thereby playing a key role in the regulation of gene expression. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39863 Product name: Recombinant human ZNF157 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC075003 Sequence: MPANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEWHRLDPAQRTMHKDVMLETYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEH Predict reactive species Full Name: zinc finger protein 157 Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC075003 Gene Symbol: ZNF157 Gene ID (NCBI): 7712 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P51786 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.