Iright
BRAND / VENDOR: Proteintech

Proteintech, 33839-1-AP, Trem2 Polyclonal antibody

CATALOG NUMBER: 33839-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Trem2 (33839-1-AP) by Proteintech is a Polyclonal antibody targeting Trem2 in WB, ELISA applications with reactivity to mouse samples 33839-1-AP targets Trem2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Trem2 (triggering receptor expressed on myeloid cells 2), a trigger receptor 2 expressed by myeloid cells, is an important immunoregulatory receptor, mainly expressed on the surface of myeloid cells such as macrophages and microglia, and plays a key role in maintaining immune homeostasis, regulating inflammation and the occurrence and development of various diseases. Trem2 is highly expressed in tumor-associated macrophages (TAMs), which plays a role in promoting tumor by inhibiting anti-tumor immunity and promoting tumor angiogenesis, thus becoming a potential target of tumor immunotherapy. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40690 Product name: Recombinant mouse Trem2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-171 aa of BC052784 Sequence: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS Predict reactive species Full Name: triggering receptor expressed on myeloid cells 2 Observed Molecular Weight: 27 kDa GenBank Accession Number: BC052784 Gene Symbol: Trem2 Gene ID (NCBI): 83433 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q99NH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924