Iright
BRAND / VENDOR: Proteintech

Proteintech, 33842-1-AP, NTNG2 Polyclonal antibody

CATALOG NUMBER: 33842-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NTNG2 (33842-1-AP) by Proteintech is a Polyclonal antibody targeting NTNG2 in WB, ELISA applications with reactivity to human, mouse, rat samples 33842-1-AP targets NTNG2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse retina tissue, rat retina tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information NTNG2, also known as Netrin-G2, belongs to the Netrin family and operates through binding with its receptors. It is involved in controlling patterning and neuronal circuit formation at the laminar, cellular, subcellular and synaptic levels. It also promotes neurite outgrowth of both axons and dendrites (PMID: 21946559). NTNG2 has two isoforms with molecular weights of 59 kDa and 47 kDa respectively. According to the Uniprot website, this protein contains a signal peptide and a propeptide, so the molecular weight of the mature protein is approximately 50 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38229 Product name: Recombinant human NTNG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-504 aa of BC013770 Sequence: MDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSFGNCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDRCNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRGYTGVRCEQPRCDPADDDGGLDCDR Predict reactive species Full Name: netrin G2 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC013770 Gene Symbol: NTNG2 Gene ID (NCBI): 84628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96CW9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924