Proteintech, 33855-1-AP, ACBD7 Polyclonal antibody

Size: 20ul / 150ul The ACBD7 (33855-1-AP) by Proteintech is a Polyclonal antibody targeting ACBD7 in ELISA applications with reactivity to human samples 33855-1-AP targets ACBD7 in ELISA applications and shows reactivity with human samples. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40829 Product name: Recombinant human ACBD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC029526 Sequence: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI Predict reactive species Full Name: acyl-Coenzyme A binding domain containing 7 Calculated Molecular Weight: 88 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC029526 Gene Symbol: ACBD7 Gene ID (NCBI): 414149 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N6N7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.