Proteintech, 33887-1-AP, ANG4 Polyclonal antibody

Size: 20ul / 150ul The ANG4 (33887-1-AP) by Proteintech is a Polyclonal antibody targeting ANG4 in WB, ELISA applications with reactivity to mouse samples 33887-1-AP targets ANG4 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse colon tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Mouse ANG4 (Angiogenin-4) is a member of the angiogenin (RNase A) family, primarily expressed and secreted specifically by intestinal Paneth cells. As a key effector molecule of intestinal innate immunity, ANG4 is an antimicrobial protein possessing ribonuclease (RNase) activity. It exerts direct bactericidal effects by cleaving bacterial tRNA-particularly in Gram-positive bacteria-thereby inhibiting their protein synthesis. This protein plays a central role in maintaining intestinal microbial homeostasis and defending against pathogen invasion. Its expression is regulated by the gut microbiota and immune signals (such as IL-22), making ANG4 an important model protein for studying host-microbe interactions and mucosal immunity. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg6823 Product name: Recombinant mouse ANG4 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-144 aa of NM_177544.4 Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP Predict reactive species Full Name: angiogenin, ribonuclease A family, member 4 Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: NM_177544.4 Gene Symbol: Ang4 Gene ID (NCBI): 219033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q3TMQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.