Product Description
Size: 20ul / 150ul
The ANG4 (33887-1-AP) by Proteintech is a Polyclonal antibody targeting ANG4 in WB, ELISA applications with reactivity to mouse samples
33887-1-AP targets ANG4 in WB, ELISA applications and shows reactivity with mouse samples.
Tested Applications
Positive WB detected in: mouse colon tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
Mouse ANG4 (Angiogenin-4) is a member of the angiogenin (RNase A) family, primarily expressed and secreted specifically by intestinal Paneth cells. As a key effector molecule of intestinal innate immunity, ANG4 is an antimicrobial protein possessing ribonuclease (RNase) activity. It exerts direct bactericidal effects by cleaving bacterial tRNA-particularly in Gram-positive bacteria-thereby inhibiting their protein synthesis. This protein plays a central role in maintaining intestinal microbial homeostasis and defending against pathogen invasion. Its expression is regulated by the gut microbiota and immune signals (such as IL-22), making ANG4 an important model protein for studying host-microbe interactions and mucosal immunity.
Specification
Tested Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Eg6823 Product name: Recombinant mouse ANG4 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-144 aa of NM_177544.4 Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP Predict reactive species
Full Name: angiogenin, ribonuclease A family, member 4
Calculated Molecular Weight: 16 kDa
Observed Molecular Weight: 16 kDa
GenBank Accession Number: NM_177544.4
Gene Symbol: Ang4
Gene ID (NCBI): 219033
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q3TMQ6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924