Iright
BRAND / VENDOR: Proteintech

Proteintech, 33925-1-AP, ROPN1B Polyclonal antibody

CATALOG NUMBER: 33925-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ROPN1B (33925-1-AP) by Proteintech is a Polyclonal antibody targeting ROPN1B in WB, ELISA applications with reactivity to human, mouse, rat samples 33925-1-AP targets ROPN1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40678 Product name: Recombinant human ROPN1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC141849 Sequence: MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAEEL Predict reactive species Full Name: ropporin, rhophilin associated protein 1B Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC141849 Gene Symbol: ROPN1B Gene ID (NCBI): 152015 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BZX4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924