Proteintech, 33929-1-AP, JKAMP Polyclonal antibody

Size: 20ul / 150ul The JKAMP (33929-1-AP) by Proteintech is a Polyclonal antibody targeting JKAMP in WB, ELISA applications with reactivity to human, mouse samples 33929-1-AP targets JKAMP in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse adipose tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information JKAMP (JNK1/MAPK8-Associated Membrane Protein) is a multi-pass transmembrane protein primarily found in the endoplasmic reticulum (ER) and plasma membrane. JKAMP plays a critical role in cellular stress responses by regulating the duration of JNK1 (MAPK8) activity. It competes with phosphatases like MKP5 to sustain JNK1 signaling, thereby influencing stress-induced apoptosis. Additionally, JKAMP is involved in the ubiquitin-dependent ER-associated degradation (ERAD) pathway, helping to degrade misfolded ER proteins by recruiting proteasomal components. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40886 Product name: Recombinant human C14orf100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC010359 Sequence: MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD Predict reactive species Full Name: chromosome 14 open reading frame 100 Calculated Molecular Weight: 311 aa, 35 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC010359 Gene Symbol: C14orf100 Gene ID (NCBI): 51528 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P055 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.