Product Description
Size: 20ul / 150ul
The FAM102A (33932-1-AP) by Proteintech is a Polyclonal antibody targeting FAM102A in WB, ELISA applications with reactivity to human samples
33932-1-AP targets FAM102A in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: SK-BR-3 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
FAM102A is a mitochondria-associated protein implicated in bone remodeling, particularly through regulation of osteoclast activity. Although lacking known catalytic domains, FAM102A appears to function as a regulatory factor linking mitochondrial processes to cellular differentiation and stress responses. Genetic associations with bone mineral density highlight its relevance in skeletal biology and metabolic regulation.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag40874 Product name: Recombinant human FAM102A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-242 aa of BC137088 Sequence: LHLSDRSFRRKKDSVESHPTWVDDTRIDADAIVEKIVQSQDFTDGSNTEDSNLRLFVSRDGSATLSGIQLATRVSSGVYEPVVIESH Predict reactive species
Full Name: family with sequence similarity 102, member A
Observed Molecular Weight: 43 kDa
GenBank Accession Number: BC137088
Gene Symbol: FAM102A
Gene ID (NCBI): 399665
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q5T9C2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924