Iright
BRAND / VENDOR: Proteintech

Proteintech, 33949-1-AP, CD297/ART4 Polyclonal antibody

CATALOG NUMBER: 33949-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD297/ART4 (33949-1-AP) by Proteintech is a Polyclonal antibody targeting CD297/ART4 in WB, ELISA applications with reactivity to mouse samples 33949-1-AP targets CD297/ART4 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: rat heart tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information CD297/ART4 is a GPI-anchored ecto-ADP-ribosyltransferase best known as the molecular carrier of Dombrock blood group antigens on erythrocytes. Expressed on red blood cells, hematopoietic progenitors, and select immune cells, it participates in cell-surface signaling and immune recognition, though its catalytic activity is limited. CD297/ART4 polymorphisms underlie clinically significant transfusion reactions, making it a key target in hematology, transfusion medicine, and erythroid biology. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg6315 Product name: Recombinant mouse CD297/ART4 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-263 aa of NM_026639.2 Sequence: GSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGDYFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMARAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGSTIRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGSPKGDLINLRSAGNMSTYNCQLLK Predict reactive species Full Name: ADP-ribosyltransferase 4 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: NM_026639.2 Gene Symbol: Art4 Gene ID (NCBI): 109978 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9CRA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924