Proteintech, 33959-1-AP, C15orf61 Polyclonal antibody

Size: 20ul / 150ul The C15orf61 (33959-1-AP) by Proteintech is a Polyclonal antibody targeting C15orf61 in WB, ELISA applications with reactivity to human samples 33959-1-AP targets C15orf61 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, MG-63 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38734 Product name: Recombinant human C15orf61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-157 aa of NM_001143936 Sequence: MRPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNWPVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTLLYGLGSWLFARVTETVHTSYGPITVYFLNKEDEGAMY Predict reactive species Full Name: chromosome 15 open reading frame 61 Calculated Molecular Weight: 18 aa Observed Molecular Weight: 16 kDa GenBank Accession Number: NM_001143936 Gene Symbol: C15orf61 Gene ID (NCBI): 145853 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NNL5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.