Iright
BRAND / VENDOR: Proteintech

Proteintech, 33982-1-AP, FAM119B Polyclonal antibody

CATALOG NUMBER: 33982-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FAM119B (33982-1-AP) by Proteintech is a Polyclonal antibody targeting FAM119B in WB, ELISA applications with reactivity to human, mouse, rat samples 33982-1-AP targets FAM119B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information EEF1AKMT3 (also known as METTL21B or FAM119B) is a gene that encodes a member of the methyltransferase-like (METTL) protein family. This enzyme functions as a specific lysine methyltransferase, with its primary and well-characterized substrate being eukaryotic translation elongation factor 1 alpha (eEF1A). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40880 Product name: Recombinant human FAM119B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC099841 Sequence: MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQ Predict reactive species Full Name: family with sequence similarity 119, member B Calculated Molecular Weight: 226 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC099841 Gene Symbol: FAM119B Gene ID (NCBI): 25895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96AZ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924